LL-37 Peptide Research Guide: Antimicrobial, Immunomodulation & Dosage Overview
A comprehensive research overview of LL-37, the only human cathelicidin antimicrobial peptide — covering its mechanism, TLR modulation, wound healing research, and administration protocols.
TL;DR
- LL-37 is the sole human cathelicidin — a host defense peptide with direct antimicrobial and immune-modulating functions
- Mechanism involves membrane disruption of bacterial cells and modulation of TLR4/TLR9 signaling
- Wound healing research shows accelerated re-epithelialization and angiogenesis
- Research doses typically 100-500 mcg via subcutaneous or intranasal routes; biofilm disruption at sub-MIC concentrations
Disclaimer: For educational and research purposes only — not medical advice.
LL-37 represents a category of compound that challenges simple classification: it is simultaneously an endogenous host-defense molecule, a broad-spectrum antimicrobial, an immune modulator, a wound healing accelerator, and a potential cancer research compound — with some of these roles appearing contradictory depending on the disease context. Understanding LL-37 requires engaging with this complexity rather than simplifying it away. This guide provides a research-level overview of what is currently known.
Human Cathelicidin: What LL-37 Is
LL-37 is a 37-amino acid cationic peptide derived from the C-terminal domain of the larger precursor protein hCAP18 (human cationic antimicrobial protein of 18 kDa), which is encoded by the CAMP gene. After synthesis, hCAP18 undergoes proteolytic cleavage by serine proteases (kallikrein-5 in skin, proteinase 3 in neutrophils) to release the active LL-37 fragment.
The peptide is named for its N-terminal leucine-leucine residues and its total length of 37 amino acids. Its sequence is: [LL-37, 37 aa]
LL-37 is expressed and secreted by:
- Neutrophils (from specific granules upon activation)
- Keratinocytes (stimulated by vitamin D3, wounding, or infection)
- Epithelial cells of the respiratory, GI, and urogenital tracts
- Monocytes, macrophages, and mast cells
- Plasma (as hCAP18, with local conversion to LL-37)
The CAMP gene is strongly upregulated by 1,25-dihydroxyvitamin D3 through a vitamin D response element in its promoter — a finding that connects vitamin D status to innate immune competence and has generated substantial research interest.
Antimicrobial Mechanism: Membrane Disruption
LL-37's primary antimicrobial mechanism involves electrostatic interactions with negatively charged bacterial membranes. Bacterial cell membranes are rich in anionic lipids (phosphatidylglycerol, cardiolipin, lipopolysaccharide in gram-negatives) — a contrast with eukaryotic membranes that are predominantly zwitterionic. This selectivity explains why LL-37 preferentially disrupts bacterial membranes without equivalent toxicity to mammalian cells.
The membrane disruption mechanism involves several proposed models:
- Carpet model: LL-37 accumulates on the membrane surface until a critical concentration causes detergent-like solubilization
- Toroidal pore model: Peptide-lipid complexes form pores lined by both peptide and lipid molecules
- Barrel-stave model: Peptide oligomers insert perpendicularly and form ion channels
In practice, the mechanism likely varies with membrane composition and local peptide concentration. At sub-lethal concentrations, LL-37 can depolarize bacterial membranes, inhibit biofilm formation, and alter gene expression without causing immediate cell death — effects relevant for its use in combination with conventional antibiotics.
Broad-spectrum activity has been demonstrated against:
- Gram-negative: E. coli, Pseudomonas aeruginosa, Salmonella, H. pylori
- Gram-positive: S. aureus (including MRSA), S. epidermidis, Enterococcus
- Fungi: Candida albicans (at higher concentrations)
- Viruses: influenza A, HIV (membrane disruption and immune activation)
TLR Modulation and Immunomodulatory Effects
Beyond direct antimicrobial activity, LL-37 serves as a critical modulator of Toll-like receptor (TLR) signaling — the pattern recognition system that bridges innate and adaptive immunity.
TLR4 modulation: LL-37 can both activate TLR4 at very low concentrations and suppress LPS-induced TLR4 signaling at higher concentrations. This paradoxical dose-dependent behavior has significant implications for sepsis research, where uncontrolled LPS-driven TLR4 activation drives cytokine storm. LL-37 may represent a mechanism for limiting endotoxin-driven inflammation during bacterial clearance.
TLR9 modulation: LL-37 forms complexes with bacterial DNA (CpG DNA), enhancing its uptake by plasmacytoid dendritic cells and amplifying TLR9 signaling. This leads to robust interferon-alpha production — important in antiviral defense.
Additional immunomodulatory activities:
- Chemotaxis of monocytes, T cells, and mast cells via FPRL1 receptor
- Induction of TNF-alpha and IL-1beta (pro-inflammatory)
- Induction of IL-10 (anti-inflammatory)
- Direct activation of mast cell degranulation
- Synergy with IL-4 and IL-13 in mucosal defense
The net immunological outcome of LL-37 depends on the tissue context, local concentration, and inflammatory milieu — making it a complex research target but also a potentially versatile therapeutic scaffold.
Wound Healing Research
Wound healing is among the most studied therapeutic applications for LL-37. Research in both animal models and in vitro systems has demonstrated multiple pro-healing activities:
Re-epithelialization: LL-37 activates epidermal growth factor receptor (EGFR) transactivation, stimulating keratinocyte migration and proliferation. Wounds in mice with knocked-out CAMP expression heal significantly more slowly than wild-type controls.
Angiogenesis: LL-37 promotes the formation of new blood vessels in wound beds by activating FPRL1 on endothelial cells, increasing VEGF production, and directly stimulating endothelial migration. This is critical for restoring tissue oxygenation in deeper wounds.
Biofilm disruption: Chronic wounds are frequently colonized by polymicrobial biofilms that resist antibiotic penetration. LL-37 at concentrations achieved in topical formulations can disrupt established biofilms and restore antibiotic sensitivity — a clinically important observation for diabetic wound research.
Protease modulation: Chronic wounds have elevated protease activity (MMP-2, MMP-9) that degrades extracellular matrix and growth factors. LL-37 appears to modulate protease activity and protect growth factors from degradation.
Research Routes and Dose Considerations
LL-37 research uses several administration routes, each with distinct characteristics:
| Route | Typical Research Dose | Key Considerations |
|---|---|---|
| Subcutaneous | 100-500 mcg | Systemic distribution; half-life ~1-2 hours |
| Intranasal | 100-300 mcg | Respiratory mucosal delivery; local + systemic |
| Topical | 0.1-1% solution | Local wound/skin application; limited penetration |
| Intravenous (animal) | 1-5 mg/kg | Research only; significant CV effects at high doses |
| Intraperitoneal (animal) | 0.5-2 mg/kg | Common in murine infection models |
A significant pharmacokinetic challenge for LL-37 research is its rapid proteolytic degradation in biological fluids. Plasma half-life is estimated at approximately 1-2 hours due to protease activity. Researchers have explored several strategies to address this:
- Retro-inverso analogs (D-amino acid versions) with protease resistance
- PEGylation to extend half-life
- Encapsulation in liposomes or nanoparticles for topical delivery
- Fragment analogs (17BIPHE2, SAAP-148) that retain activity with improved stability
Biofilm Disruption Research
Biofilm-forming bacteria represent one of the most significant challenges in infectious disease research, particularly for chronic wound, catheter, and implant-associated infections. Conventional antibiotics fail against mature biofilms for several reasons:
- Physical barrier of the biofilm matrix (polysaccharides, eDNA, proteins) limits antibiotic penetration
- Metabolically inactive persister cells are tolerant to antibiotics that target active metabolism
- Reduced local pH and oxygen tension alter antibiotic activity
LL-37 disrupts biofilms through mechanisms that differ from conventional antibiotics:
- Direct disruption of the biofilm matrix by binding eDNA (a structural component)
- Penetration through biofilm architecture via its cationic charge
- Activity against metabolically quiescent persister cells
- Sub-MIC inhibition of initial biofilm attachment
Research has demonstrated that concentrations of LL-37 well below the MIC for planktonic cells can effectively prevent biofilm formation by P. aeruginosa and S. aureus. At 0.5-2× MIC, established biofilms show significant biomass reduction. Combinations of LL-37 with conventional antibiotics show synergy — the peptide disrupts the biofilm structure while antibiotic concentrations that would be subtherapeutic against the biofilm alone become effective.
Frequently Asked Questions
Q: Is LL-37 relevant for skin conditions like psoriasis? A: LL-37 is actually implicated as a driver of psoriatic pathology. In psoriasis, elevated LL-37 from keratinocytes forms complexes with self-DNA, activating plasmacytoid dendritic cells through TLR9 to produce interferon-alpha, triggering the inflammatory cascade. This illustrates how the same molecule can be protective (clearing bacterial infection) or pathological (driving autoimmunity) depending on context.
Q: How should LL-37 be reconstituted for research use? A: LL-37 is typically reconstituted in sterile water or 0.9% saline to concentrations of 1-5 mg/mL. It is amphipathic and can aggregate at high concentrations — gentle vortexing rather than sonication is recommended. Acetic acid (0.1%) can improve solubility for some formulations. Store reconstituted solutions at -20°C; freeze-thaw cycles degrade activity.
Q: What are the main safety concerns for LL-37 research? A: At doses used in local or topical research applications, LL-37 has a favorable safety profile in animal models. At high systemic doses, hemolytic activity and cardiovascular effects have been observed in vitro and in rodent models. The therapeutic window for systemic administration is an active area of investigation.
Use the Reconstitution Calculator [→ /calculators/reconstitution — Calculate LL-37 reconstitution volume and dosing math]
For educational and research purposes only. Not medical advice.
Disclaimer: For educational and research purposes only. Nothing in this article constitutes medical advice, diagnosis, or treatment recommendation. All compounds discussed are research chemicals or investigational compounds unless explicitly noted otherwise. Consult a qualified healthcare professional before making any health-related decisions. Researchers must comply with all applicable laws and regulations in their jurisdiction.
Written by the Peptide Performance Calculator Research Team
Our team compiles research guides based on published literature for educational purposes. All content is for research use only — not medical advice. Read our disclaimer.
Frequently Asked Questions
What makes LL-37 different from other antimicrobial peptides?
LL-37 is the only member of the cathelicidin family expressed in humans, making it uniquely relevant for translational research. Unlike most AMPs that are purely lytic, LL-37 has a dual role as both a direct antimicrobial and an immune signaling molecule — it can either amplify or suppress inflammation depending on context.
What research doses of LL-37 are used in published studies?
In vitro studies use wide concentration ranges (0.5-50 µg/mL). In vivo animal research typically uses 100-500 mcg per administration, often locally applied to wound sites or administered intranasally. Human research remains in early stages; no established clinical dosing protocol exists for systemic LL-37 administration.
Can LL-37 disrupt biofilms that antibiotics cannot penetrate?
Yes — this is one of the most clinically compelling areas of LL-37 research. LL-37 has demonstrated the ability to disrupt established biofilms of Pseudomonas aeruginosa, Staphylococcus aureus, and other pathogens at concentrations achievable in wound research models. It also inhibits biofilm formation at sub-MIC concentrations.
New compound guides and calculator updates — no spam, unsubscribe any time.
Free Peptide Calculators
7 free calculators covering reconstitution, dosage, syringe units, half-life, injection volume, stack planning, and cycle duration — no account needed.